PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g59410.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 268aa    MW: 31147.7 Da    PI: 6.2629
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g59410.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.82.4e-24150197552
            RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       +++e +s++F  pik+AA eL+v+lT LKr+CR++GI+RWPhRk++sl
  Bradi3g59410.3.p 150 LTFELVSQHFCVPIKQAAAELKVGLTQLKRRCRELGIPRWPHRKMRSL 197
                       89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086131218IPR003035RWP-RK domain
PfamPF020421.4E-21150197IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MNVFPFKSSA SINCSGHLWL RLPRSAMLQL PPMEDFRFYE EEGYYFRDLK FHNDEYFQDF  60
SIEYLQEESP FFSTQHRLCT STATATQSYF CQDELYALFQ GDILSLWAAL EEEAPCKSEK  120
ELELEQKLGP DAVEKTRMSN GPPEQEKPLL TFELVSQHFC VPIKQAAAEL KVGLTQLKRR  180
CRELGIPRWP HRKMRSLQTL IDNVQELGRG TGEDGGMTKI VVEMLQQTKK LMEERPGDVE  240
LDHTTKMLRQ KCFKENYKRK RLMALQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756209.11e-180PREDICTED: protein RKD1-like
TrEMBLI1IFB61e-170I1IFB6_BRADI; Uncharacterized protein
STRINGBRADI3G59410.11e-170(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-32RWP-RK domain-containing protein